>2k6n_A mol:protein length:67  Supervillin
MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVN
LKKAKGLF
>2k6n_A mol:protein length:67  Supervillin
MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVN
LKKAKGLF