>2k6t_B mol:protein length:31  Insulin-like 3 B chain
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA
>2k6t_A mol:protein length:26  Insulin-like 3 A chain
AAATNPARYCCLSGCTQQDLLTLCPY
>2k6t_B mol:protein length:31  Insulin-like 3 B chain
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA