>2kn1_A mol:protein length:51  Tumor necrosis factor receptor superfamily member 17
LQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKCX