>2ku3_A mol:protein length:71  Bromodomain-containing protein 1
MGHHHHHHMQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWL
CRHCLQSRARPA