>2kum_A mol:protein length:88  C-C motif chemokine 27
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP
SLSQWFEHQERKLHGTLPKLNFGMLRKMG
>2kum_A mol:protein length:88  C-C motif chemokine 27
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP
SLSQWFEHQERKLHGTLPKLNFGMLRKMG