>2kvq_G mol:protein length:63  Transcription antitermination protein nusG
GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQ
VEKA
>2kvq_G mol:protein length:63  Transcription antitermination protein nusG
GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQ
VEKA
>2kvq_E mol:protein length:87  NusE
GPLGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVD
IVEPTEKTVDALMRLDLAAGVDVQISLG