>2kwo_B mol:protein length:20  Histone peptide
SGRGKGGKGLGKGGAKRHRK
>2kwo_A mol:protein length:114  Zinc finger protein DPF3
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECK
SCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
>2kwo_A mol:protein length:114  Zinc finger protein DPF3
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECK
SCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS