>2l1r_B mol:protein length:20  Troponin I
RRVRISADAMMQALLGARAK
>2l1r_B mol:protein length:20  Troponin I
RRVRISADAMMQALLGARAK
>2l1r_A mol:protein length:89  Troponin C
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQE
MIDEVDEDGSGTVDFDEFLVMMVRCMKDDS