>2l35_A mol:protein length:63  DAP12-NKG2C_TM
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPF
LEQN
>2l35_B mol:protein length:32  TYRO protein tyrosine kinase-binding protein
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR
>2l35_B mol:protein length:32  TYRO protein tyrosine kinase-binding protein
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR