>2l35_A mol:protein length:63  DAP12-NKG2C_TM
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPF
LEQN