>2l6w_B mol:protein length:39  Beta-type platelet-derived growth factor receptor
GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE