>2ld1_A mol:protein length:142  Transcriptional regulator ATRX
GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDS
DGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEP
LLDLVTACNSVFENLEQLLQQNKK
>2ld1_A mol:protein length:142  Transcriptional regulator ATRX
GAMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDS
DGMDEQCRWCAEGGNLICCDFCHNAFCKKCILRNLGRKELSTIMDENNQWYCYICHPEP
LLDLVTACNSVFENLEQLLQQNKK