>2ldx_B mol:protein length:331  APO-LACTATE DEHYDROGENASE
STVKEQLIQNLVPEDKLSRCKITVVGVGDVGMACAISILLKGLADELALVDADTDKLRG
EALDLQHGSLFLSTPKIVFGKDYNVSANSKLVIITAGARMVSGQTRLDLLQRNVAIMKA
IVPGVIQNSPDCKIIVVTNPVDILTYVVWKISGFPVGRVIGSGCNLDSARFRYLIGEKL
GVNPTSCHGWVLGEHGDSSVPIWSGVNVAGVTLKSLNPAIGTDKNKQHWKNVHKQVVEG
GYEVLDMKGYTSWAIGLSVTDLARSILKNLKRVHPVTTLVKGFHGIKEEVFLSIPCVLG
ESGITDFVKVNMTAEEEGLLKKSADTLWNMQKNLEL