>2lpz_B mol:protein length:80  Protein prgI
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRN
AQSNTVKVFKDIDAAIIQNFR