>2lpz_J mol:protein length:80  Protein prgI
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRN
AQSNTVKVFKDIDAAIIQNFR