>2lpz_M mol:protein length:80  Protein prgI
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRN
AQSNTVKVFKDIDAAIIQNFR