>2lpz_O mol:protein length:80  Protein prgI
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRN
AQSNTVKVFKDIDAAIIQNFR