>2lpz_Q mol:protein length:80  Protein prgI
MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRN
AQSNTVKVFKDIDAAIIQNFR