>2lq6_A mol:protein length:87  Bromodomain-containing protein 1
MGHHHHHHMNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEP
VKELTGGGTTFSVRKTAYCDVHTPPGST
>2lq6_A mol:protein length:87  Bromodomain-containing protein 1
MGHHHHHHMNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEP
VKELTGGGTTFSVRKTAYCDVHTPPGST