>2lux_A mol:protein length:93  Protein S100-A1
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVAMNNFFWENS