>2m9a_A mol:protein length:98  E3 ubiquitin-protein ligase ZFP91
MGHHHHHHSHMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNW
HMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV
>2m9a_A mol:protein length:98  E3 ubiquitin-protein ligase ZFP91
MGHHHHHHSHMRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNW
HMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEV