>2mf0_C mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH