>2mf1_E mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH
>2mf1_G mol:na length:72  RNA_(72-MER)
UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUC
AUCAGGACGAUGA
>2mf1_B mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH
>2mf1_C mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH
>2mf1_D mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH
>2mf1_G mol:na length:72  RNA_(72-MER)
UGUCGACGGAUAGACACAGCCAUCAAGGACGAUGGUCAGGACAUCGCAGGAAGCGAUUC
AUCAGGACGAUGA
>2mf1_A mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH
>2mf1_F mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH