>2mf1_F mol:protein length:70  Carbon storage regulator homolog
MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD
KRETPHHHHHH