>2mib_A mol:protein length:152  INTERLEUKIN-1 BETA
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVA
LGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFP
NWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS