>2mkj_A mol:protein length:203  Cytoplasmic polyadenylation element-binding protein 4
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYA
FLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLD
PRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYI
AAISARFVQLQHGEIDKRVEVKPYVL