>2mpf_A mol:protein length:158  Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
GPSSPMELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIR
EGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYS
LSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH