>2mpr_C mol:protein length:427  MALTOPORIN
VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFY
FDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFY
YWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNIYDEVKDTANDVFDVRLA
GLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYAT
DAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWD
LMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYK
ITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAAATNSGISTNSRGD
SDEWTFGAQMEIWW
>2mpr_C mol:protein length:427  MALTOPORIN
VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFY
FDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFY
YWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNIYDEVKDTANDVFDVRLA
GLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYAT
DAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWD
LMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYK
ITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAAATNSGISTNSRGD
SDEWTFGAQMEIWW
>2mpr_A mol:protein length:427  MALTOPORIN
VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFY
FDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFY
YWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNIYDEVKDTANDVFDVRLA
GLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYAT
DAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWD
LMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYK
ITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAAATNSGISTNSRGD
SDEWTFGAQMEIWW
>2mpr_B mol:protein length:427  MALTOPORIN
VDFHGYARSGIGWTGSGGEQQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFY
FDTNVAYSVNQQNDWESTDPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFY
YWDISGPGAGIENIDLGFGKLSLAATRSTEAGGSYTFSSQNIYDEVKDTANDVFDVRLA
GLQTNPDGVLELGVDYGRANTTDGYKLADGASKDGWMFTAEHTQSMLKGYNKFVVQYAT
DAMTTQGKGQARGSDGSSSFTEELSDGTKINYANKVINNNGNMWRILDHGAISLGDKWD
LMYVGMYQNIDWDNNLGTEWWTVGVRPMYKWTPIMSTLLEVGYDNVKSQQTGDRNNQYK
ITLAQQWQAGDSIWSRPAIRIFATYAKWDEKWGYIKDGDNISRYAAATNSGISTNSRGD
SDEWTFGAQMEIWW