>2n0k_A mol:protein length:89  Alpha-crystallin B chain
GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVDGPRKQV
>2n0k_B mol:protein length:89  Alpha-crystallin B chain
GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVDGPRKQV
>2n0k_B mol:protein length:89  Alpha-crystallin B chain
GLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKY
RIPADVDPLTITSSLSSDGVLTVDGPRKQV