>2n8a_A mol:protein length:214  Poly [ADP-ribose] polymerase 1
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWK
VGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYA
KSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYS
ASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVD