>2nmy_B mol:protein length:99  PROTEASE
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQY
DQIIIEIAGHKAIGTVLVGPTPANIIGRNLLTQIGATLNF