>2ntc_A mol:protein length:134  large T antigen
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRH
NSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEE
SLPGGLKEHDFNPESS
>2ntc_C mol:na length:21  21-nt PEN element of the SV40 DNA origin
TCAGAGGCCAGAAGTGCCTCG
>2ntc_C mol:na length:21  21-nt PEN element of the SV40 DNA origin
TCAGAGGCCAGAAGTGCCTCG
>2ntc_W mol:na length:21  21-nt PEN element of the SV40 DNA origin
ACGAGGCACTTCTGGCCTCTG
>2ntc_B mol:protein length:134  large T antigen
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRH
NSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEE
SLPGGLKEHDFNPESS