>2nuf_A mol:protein length:221  Ribonuclease III
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYS
PNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYI
DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEG
PHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
>2nuf_D mol:na length:28  28-MER
CAAGGUCAUUCGCAAGAGUGGCCUUGCG
>2nuf_C mol:na length:28  28-MER
CAAGGUCAUUCGCAAGAGUGGCCUUGCG
>2nuf_B mol:protein length:221  Ribonuclease III
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYS
PNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYI
DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEG
PHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE
>2nuf_D mol:na length:28  28-MER
CAAGGUCAUUCGCAAGAGUGGCCUUGCG