>2nug_A mol:protein length:221  Ribonuclease III
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYS
PNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYI
DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEG
PHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEESE