>2nvt_H mol:protein length:146  DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTI
ASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSF
GGLLMRLEGNYRNLNNLKQENAYLLIRR