>2o4p_B mol:protein length:99  protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>2o4p_B mol:protein length:99  protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>2o4p_A mol:protein length:99  protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF