>2o93_A mol:na length:25  kappaB enhancer element, DNA 25-mer
AGGGACTTTCCGCTGGGGACTTTCC
>2o93_B mol:na length:25  kappaB enhancer element, DNA 25-mer
TGGAAAGTCCCCAGCGGAAAGTCCC
>2o93_O mol:protein length:301  actor of activated T-cells, cytoplasmic 2
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAP
TGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN
TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESS
GRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTE
KTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQH
FTYHPV
>2o93_L mol:protein length:301  actor of activated T-cells, cytoplasmic 2
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAP
TGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN
TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESS
GRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTE
KTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQH
FTYHPV
>2o93_M mol:protein length:301  actor of activated T-cells, cytoplasmic 2
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAP
TGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN
TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESS
GRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTE
KTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQH
FTYHPV
>2o93_B mol:na length:25  kappaB enhancer element, DNA 25-mer
TGGAAAGTCCCCAGCGGAAAGTCCC