>2o93_M mol:protein length:301  actor of activated T-cells, cytoplasmic 2
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAP
TGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGN
TKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESS
GRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTE
KTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQH
FTYHPV