>2om2_D mol:protein length:36  Regulator of G-protein signalling 14 GoLoco motif peptide
DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ