>2opg_A mol:protein length:98  Multiple PDZ domain protein
SMGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVN
GIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKSTRL