>2ott_X mol:protein length:98  T-cell surface glycoprotein CD5
PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVL
DAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQD