>2ov2_P mol:protein length:35  Serine/threonine-protein kinase PAK 4
EISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIE