>2p18_A mol:protein length:311  Glyoxalase II
HHHHHHSSGLVPRGSHMRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVN
ADYKPILTYIEEHLKQQGNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVV
VVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALF
TGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFS
EKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMN
QGNAHALMMYLYNACD
>2p18_A mol:protein length:311  Glyoxalase II
HHHHHHSSGLVPRGSHMRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVN
ADYKPILTYIEEHLKQQGNADVTYTFSTILSTHKHWDHSGGNAKLKAELEAMNSTVPVV
VVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALF
TGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFS
EKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMN
QGNAHALMMYLYNACD