>2p1q_A mol:protein length:160  SKP1-like protein 1A
MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYC
KRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTC
QTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE