>2p5l_D mol:protein length:64  Arginine repressor
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGS
YKYSL
>2p5l_G mol:protein length:64  Arginine repressor
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGS
YKYSL
>2p5l_F mol:na length:18  DNA (5'-D(*DCP*DTP*DTP*DGP*DAP*DAP*DTP*DTP*DTP*DTP*DTP*DAP*DTP*DTP*DCP*DAP*DTP*DG)-3')
CTTGAATTTTTATTCATG
>2p5l_A mol:na length:18  DNA (5'-D(*DCP*DAP*DTP*DGP*DAP*DAP*DTP*DAP*DAP*DAP*DAP*DAP*DTP*DTP*DCP*DAP*DAP*DG)-3')
CATGAATAAAAATTCAAG
>2p5l_H mol:protein length:64  Arginine repressor
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGS
YKYSL
>2p5l_B mol:na length:18  DNA (5'-D(*DCP*DTP*DTP*DGP*DAP*DAP*DTP*DTP*DTP*DTP*DTP*DAP*DTP*DTP*DCP*DAP*DTP*DG)-3')
CTTGAATTTTTATTCATG
>2p5l_F mol:na length:18  DNA (5'-D(*DCP*DTP*DTP*DGP*DAP*DAP*DTP*DTP*DTP*DTP*DTP*DAP*DTP*DTP*DCP*DAP*DTP*DG)-3')
CTTGAATTTTTATTCATG
>2p5l_C mol:protein length:64  Arginine repressor
MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGS
YKYSL
>2p5l_E mol:na length:18  DNA (5'-D(*DCP*DAP*DTP*DGP*DAP*DAP*DTP*DAP*DAP*DAP*DAP*DAP*DTP*DTP*DCP*DAP*DAP*DG)-3')
CATGAATAAAAATTCAAG