>2pc0_A mol:protein length:99  Protease
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQY
DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF