>2pi8_D mol:protein length:345  Membrane-bound lytic murein transglycosylase A
MSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSN
VYNAVQEWLRAGGDTRNMRQFGIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQY
PIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMDVQGSGYIDFGDGSPLNF
FSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFF
KPQSFAPVKGASAVPLVGRASVASDRSIIPPGTTLIAEVPLLDNNGKFNGQYELRLMVA
LDVGGAIKGQHFAIYQGIGPEAGHRAGWYNHYGRVWVLKTAPGAGNVFSG