>2pph_A mol:protein length:94  Mitogen-activated protein kinase kinase kinase 3
MQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDD
LDKAIDILDRSSSMKSLRILLLSQDRNLEHHHHHH