>2prf_A mol:protein length:125  PROFILIN IA
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASG
FDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLAD
YLIGQGF