>2q0n_B mol:protein length:11  Synthetic peptide
RRRRRSWYFDG
>2q0n_B mol:protein length:11  Synthetic peptide
RRRRRSWYFDG
>2q0n_A mol:protein length:301  Serine/threonine-protein kinase PAK 4
SPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAV
KKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVT
HTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSK
EVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKM
IRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLM
RQNRTR